SCOPe 2.05: Domain d4zqqa_: 4zqq A:

Lineage for d4zqqa_ (4zqq A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (5 species)

7. Species Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId:211044] [272056] (5 PDB entries)

8. Domain d4zqqa_: 4zqq A: [273590]
   automated match to d4e5ed_
   complexed with mn, so4

Details for d4zqqa_

PDB Entry: 4zqq, 1.8 Å

PDB Description: apo form of influenza strain h1n1 polymerase acidic subunit n-terminal region

PDB Compounds: (A:) Polymerase acidic protein,Polymerase acidic protein

SCOPe Domain Sequences for d4zqqa_:

Sequence; same for both SEQRES and ATOM records:

>d4zqqa_ c.52.1.34 (A:) PA N-terminal domain {Influenza a virus (strain a/puerto rico/8/1934 h1n1) [TaxId: 211044]}
gplgsmedfvrqcfnpmivelaektmkeygedlkietnkfaaicthlevcfmysdaskhr
feiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfieigvtrrevhiyyleka
nkiksekthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqse
r

Timeline for d4zqqa_:

• d4zqqa_ is new in SCOPe 2.05-stable
  
• d4zqqa_ is called d4zqqa1 in SCOPe 2.06
  
• d4zqqa_ appears in the current release, SCOPe 2.08, called d4zqqa1