SCOPe 2.05: Domain d4z7ve1: 4z7v E:2-128

Lineage for d4z7ve1 (4z7v E:2-128)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4z7ve1: 4z7v E:2-128 [273586]
   Other proteins in same PDB: d4z7va1, d4z7va2, d4z7vb1, d4z7vc1, d4z7vc2, d4z7vd1, d4z7ve2, d4z7vg2
   automated match to d2ak4d1
   complexed with fuc, man, nag

Details for d4z7ve1

PDB Entry: 4z7v, 2.65 Å

PDB Description: l3-12 complex

PDB Compounds: (E:) T-cell receptor, l3-12 alpha chain

SCOPe Domain Sequences for d4z7ve1:

Sequence; same for both SEQRES and ATOM records:

>d4z7ve1 b.1.1.0 (E:2-128) automated matches {Homo sapiens [TaxId: 9606]}
dakttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrma
slaiaedrksstlilhratlrdaavyycilrdsraqklvfgqgtrltinp

Timeline for d4z7ve1:

• d4z7ve1 is new in SCOPe 2.05-stable
  
• d4z7ve1 appears in SCOPe 2.06
  
• d4z7ve1 appears in the current release, SCOPe 2.08