SCOPe 2.07: Domain d4z7wh2: 4z7w H:129-257

Lineage for d4z7wh2 (4z7w H:129-257)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4z7wh2: 4z7w H:129-257 [273583]
   Other proteins in same PDB: d4z7wa1, d4z7wb1, d4z7wb2, d4z7wc1, d4z7wd1, d4z7wd2, d4z7we1, d4z7wf1, d4z7wg1, d4z7wh1
   automated match to d2esve2
   complexed with fuc, man, nag, so4

Details for d4z7wh2

PDB Entry: 4z7w, 2.89 Å

PDB Description: t316 complex

PDB Compounds: (H:) T-cell receptor, t316 beta chain

SCOPe Domain Sequences for d4z7wh2:

Sequence, based on SEQRES records:

>d4z7wh2 b.1.1.2 (H:129-257) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Sequence, based on observed residues (ATOM records):

>d4z7wh2 b.1.1.2 (H:129-257) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
peqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsa
eawgrad

Timeline for d4z7wh2:

• d4z7wh2 first appeared in SCOPe 2.05
  
• d4z7wh2 appears in SCOPe 2.06
  
• d4z7wh2 appears in the current release, SCOPe 2.08