SCOPe 2.08: Domain d4z7wh1: 4z7w H:3-128

Lineage for d4z7wh1 (4z7w H:3-128)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

Domain d4z7wh1: 4z7w H:3-128 [273582]
Other proteins in same PDB: d4z7wa1, d4z7wa2, d4z7wb1, d4z7wb2, d4z7wc1, d4z7wc2, d4z7wd1, d4z7wd2, d4z7we1, d4z7we2, d4z7wf2, d4z7wg1, d4z7wg2, d4z7wh2
automated match to d2ak4e1
complexed with nag, so4

Details for d4z7wh1

PDB Entry: 4z7w (more details), 2.89 Å

PDB Description: t316 complex

PDB Compounds: (H:) T-cell receptor, t316 beta chain

SCOPe Domain Sequences for d4z7wh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7wh1 b.1.1.1 (H:3-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcassearryneqffgpgtrltvle

SCOPe Domain Coordinates for d4z7wh1:

Click to download the PDB-style file with coordinates for d4z7wh1.
(The format of our PDB-style files is described here.)

Timeline for d4z7wh1: