![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4z7wg2: 4z7w G:130-215 [273566] Other proteins in same PDB: d4z7wa1, d4z7wb1, d4z7wb2, d4z7wc1, d4z7wd1, d4z7wd2, d4z7we1, d4z7wf1, d4z7wg1, d4z7wh1 automated match to d2f54d2 complexed with nag, so4 |
PDB Entry: 4z7w (more details), 2.89 Å
SCOPe Domain Sequences for d4z7wg2:
Sequence, based on SEQRES records: (download)
>d4z7wg2 b.1.1.2 (G:130-215) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtf
>d4z7wg2 b.1.1.2 (G:130-215) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcsmdfksnsavaws nksdfacannsiipedtf
Timeline for d4z7wg2: