SCOPe 2.08: Domain d4z7wd2: 4z7w D:93-189

Lineage for d4z7wd2 (4z7w D:93-189)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4z7wd2: 4z7w D:93-189 [273560]
   Other proteins in same PDB: d4z7wa1, d4z7wa2, d4z7wb1, d4z7wc1, d4z7wc2, d4z7wd1, d4z7we2, d4z7wf1, d4z7wf2, d4z7wg2, d4z7wh1, d4z7wh2
   automated match to d1sebb1
   complexed with nag, so4

Details for d4z7wd2

PDB Entry: 4z7w, 2.89 Å

PDB Description: t316 complex

PDB Compounds: (D:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d4z7wd2:

Sequence, based on SEQRES records:

>d4z7wd2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqnpiivewr

Sequence, based on observed residues (ATOM records):

>d4z7wd2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispshnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilv
mlemtpqrgdvytchvehpslqnpiivewr

Timeline for d4z7wd2:

• d4z7wd2 first appeared in SCOPe 2.05
  
• d4z7wd2 appears in SCOPe 2.07