SCOPe 2.06: Domain d4z7wd1: 4z7w D:3-92

Lineage for d4z7wd1 (4z7w D:3-92)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d4z7wd1: 4z7w D:3-92 [273559]
   Other proteins in same PDB: d4z7wa2, d4z7wb2, d4z7wc2, d4z7wd2, d4z7we1, d4z7we2, d4z7wf1, d4z7wf2, d4z7wg1, d4z7wg2, d4z7wh1, d4z7wh2
   automated match to d1klub2
   complexed with fuc, man, nag, so4

Details for d4z7wd1

PDB Entry: 4z7w, 2.89 Å

PDB Description: t316 complex

PDB Compounds: (D:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d4z7wd1:

Sequence; same for both SEQRES and ATOM records:

>d4z7wd1 d.19.1.0 (D:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
sqkevlertraeldtvcrhnyqlelrttlq

Timeline for d4z7wd1:

• d4z7wd1 first appeared in SCOPe 2.05
  
• d4z7wd1 appears in SCOPe 2.07
  
• d4z7wd1 appears in the current release, SCOPe 2.08