Lineage for d4z7wd1 (4z7w D:3-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938859Domain d4z7wd1: 4z7w D:3-92 [273559]
    Other proteins in same PDB: d4z7wa2, d4z7wb2, d4z7wc2, d4z7wd2, d4z7we1, d4z7we2, d4z7wf1, d4z7wf2, d4z7wg1, d4z7wg2, d4z7wh1, d4z7wh2
    automated match to d1klub2
    complexed with nag, so4

Details for d4z7wd1

PDB Entry: 4z7w (more details), 2.89 Å

PDB Description: t316 complex
PDB Compounds: (D:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d4z7wd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7wd1 d.19.1.0 (D:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
sqkevlertraeldtvcrhnyqlelrttlq

SCOPe Domain Coordinates for d4z7wd1:

Click to download the PDB-style file with coordinates for d4z7wd1.
(The format of our PDB-style files is described here.)

Timeline for d4z7wd1: