| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4z7uh2: 4z7u H:129-256 [273556] Other proteins in same PDB: d4z7ua1, d4z7ua2, d4z7ub1, d4z7uc1, d4z7uc2, d4z7ud1, d4z7ue2, d4z7ug2 automated match to d2vlme2 complexed with nag |
PDB Entry: 4z7u (more details), 2.7 Å
SCOPe Domain Sequences for d4z7uh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z7uh2 b.1.1.0 (H:129-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra
Timeline for d4z7uh2: