Lineage for d4z7we1 (4z7w E:2-129)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2357432Domain d4z7we1: 4z7w E:2-129 [273551]
    Other proteins in same PDB: d4z7wa1, d4z7wa2, d4z7wb1, d4z7wc1, d4z7wc2, d4z7wd1, d4z7we2, d4z7wf1, d4z7wf2, d4z7wg2, d4z7wh1, d4z7wh2
    automated match to d2f54d1
    complexed with fuc, man, nag, so4

Details for d4z7we1

PDB Entry: 4z7w (more details), 2.89 Å

PDB Description: t316 complex
PDB Compounds: (E:) T-cell receptor, t316 alpha chain

SCOPe Domain Sequences for d4z7we1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7we1 b.1.1.0 (E:2-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvtqpdihitvsegaslelrcnysygatpylfwyvqspgqglqlllkyfsgdtlvqgik
gfeaefkrsqssfnlrkpsvhwsdaaeyfcavgetgannlffgtgtrltvipy

SCOPe Domain Coordinates for d4z7we1:

Click to download the PDB-style file with coordinates for d4z7we1.
(The format of our PDB-style files is described here.)

Timeline for d4z7we1: