Lineage for d4z7ub1 (4z7u B:2-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938821Domain d4z7ub1: 4z7u B:2-92 [273549]
    Other proteins in same PDB: d4z7ua2, d4z7ub2, d4z7uc2, d4z7ud2, d4z7ue1, d4z7ue2, d4z7uf1, d4z7uf2, d4z7ug1, d4z7ug2, d4z7uh1, d4z7uh2
    automated match to d1klub2
    complexed with nag

Details for d4z7ub1

PDB Entry: 4z7u (more details), 2.7 Å

PDB Description: s13 complex
PDB Compounds: (B:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d4z7ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7ub1 d.19.1.0 (B:2-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
nsqkevlertraeldtvcrhnyqlelrttlq

SCOPe Domain Coordinates for d4z7ub1:

Click to download the PDB-style file with coordinates for d4z7ub1.
(The format of our PDB-style files is described here.)

Timeline for d4z7ub1: