SCOPe 2.08: Domain d4z7ub1: 4z7u B:2-92

Lineage for d4z7ub1 (4z7u B:2-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d4z7ub1: 4z7u B:2-92 [273549]
   Other proteins in same PDB: d4z7ua2, d4z7ub2, d4z7uc2, d4z7ud2, d4z7ue1, d4z7ue2, d4z7uf1, d4z7uf2, d4z7ug1, d4z7ug2, d4z7uh1, d4z7uh2
   automated match to d1klub2
   complexed with nag

Details for d4z7ub1

PDB Entry: 4z7u, 2.7 Å

PDB Description: s13 complex

PDB Compounds: (B:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d4z7ub1:

Sequence; same for both SEQRES and ATOM records:

>d4z7ub1 d.19.1.0 (B:2-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
nsqkevlertraeldtvcrhnyqlelrttlq

Timeline for d4z7ub1:

• d4z7ub1 first appeared in SCOPe 2.05
  
• d4z7ub1 appears in SCOPe 2.07