SCOPe 2.06: Domain d4z7ud2: 4z7u D:93-189

Lineage for d4z7ud2 (4z7u D:93-189)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4z7ud2: 4z7u D:93-189 [273548]
   Other proteins in same PDB: d4z7ua1, d4z7ua2, d4z7ub1, d4z7uc1, d4z7uc2, d4z7ud1, d4z7ue2, d4z7ug2
   automated match to d1sebb1
   complexed with fuc, nag

Details for d4z7ud2

PDB Entry: 4z7u, 2.7 Å

PDB Description: s13 complex

PDB Compounds: (D:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d4z7ud2:

Sequence, based on SEQRES records:

>d4z7ud2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqnpiivewr

Sequence, based on observed residues (ATOM records):

>d4z7ud2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsllvcsvtdfypaqikvrwqeettgvvstplirngdwtfqilvmlemrg
dvytchvehpslqnpiivewr

Timeline for d4z7ud2:

• d4z7ud2 first appeared in SCOPe 2.05
  
• d4z7ud2 appears in SCOPe 2.07
  
• d4z7ud2 appears in the current release, SCOPe 2.08