| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4z7ud2: 4z7u D:93-189 [273548] Other proteins in same PDB: d4z7ua1, d4z7ua2, d4z7ub1, d4z7uc1, d4z7uc2, d4z7ud1, d4z7ue2, d4z7ug2 automated match to d1sebb1 complexed with nag |
PDB Entry: 4z7u (more details), 2.7 Å
SCOPe Domain Sequences for d4z7ud2:
Sequence, based on SEQRES records: (download)
>d4z7ud2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqnpiivewr
>d4z7ud2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsllvcsvtdfypaqikvrwqeettgvvstplirngdwtfqilvmlemrg
dvytchvehpslqnpiivewr
Timeline for d4z7ud2: