Lineage for d4z7wc2 (4z7w C:82-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751623Domain d4z7wc2: 4z7w C:82-180 [273544]
    Other proteins in same PDB: d4z7wa1, d4z7wb1, d4z7wb2, d4z7wc1, d4z7wd1, d4z7wd2, d4z7we1, d4z7wf1, d4z7wg1, d4z7wh1
    automated match to d1uvqa1
    complexed with nag, so4

Details for d4z7wc2

PDB Entry: 4z7w (more details), 2.89 Å

PDB Description: t316 complex
PDB Compounds: (C:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d4z7wc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7wc2 b.1.1.2 (C:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldepllkhwep

SCOPe Domain Coordinates for d4z7wc2:

Click to download the PDB-style file with coordinates for d4z7wc2.
(The format of our PDB-style files is described here.)

Timeline for d4z7wc2: