Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries) |
Domain d4z7ua2: 4z7u A:82-180 [273542] Other proteins in same PDB: d4z7ua1, d4z7ub1, d4z7ub2, d4z7uc1, d4z7ud1, d4z7ud2, d4z7ue1, d4z7uf1, d4z7uf2, d4z7ug1, d4z7uh1, d4z7uh2 automated match to d1uvqa1 complexed with fuc, nag |
PDB Entry: 4z7u (more details), 2.7 Å
SCOPe Domain Sequences for d4z7ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z7ua2 b.1.1.2 (A:82-180) automated matches {Homo sapiens [TaxId: 9606]} atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks dhsffkisyltflpsadeiydckvehwgldepllkhwep
Timeline for d4z7ua2: