Lineage for d4z7ua1 (4z7u A:0-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2183623Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2183624Protein automated matches [226842] (4 species)
    not a true protein
  7. 2183637Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)
  8. 2183752Domain d4z7ua1: 4z7u A:0-81 [273541]
    Other proteins in same PDB: d4z7ua2, d4z7ub2, d4z7uc2, d4z7ud2, d4z7ue1, d4z7ue2, d4z7uf1, d4z7uf2, d4z7ug1, d4z7ug2, d4z7uh1, d4z7uh2
    automated match to d1uvqa2
    complexed with fuc, nag

Details for d4z7ua1

PDB Entry: 4z7u (more details), 2.7 Å

PDB Description: s13 complex
PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d4z7ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7ua1 d.19.1.0 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf
altniavlkhnlnivikrsnsta

SCOPe Domain Coordinates for d4z7ua1:

Click to download the PDB-style file with coordinates for d4z7ua1.
(The format of our PDB-style files is described here.)

Timeline for d4z7ua1: