Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d4z7uc1: 4z7u C:-1-81 [273539] Other proteins in same PDB: d4z7ua2, d4z7ub2, d4z7uc2, d4z7ud2, d4z7ue1, d4z7ue2, d4z7uf1, d4z7uf2, d4z7ug1, d4z7ug2, d4z7uh1, d4z7uh2 automated match to d1uvqa2 complexed with nag |
PDB Entry: 4z7u (more details), 2.7 Å
SCOPe Domain Sequences for d4z7uc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z7uc1 d.19.1.0 (C:-1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf altniavlkhnlnivikrsnsta
Timeline for d4z7uc1: