Lineage for d4ydjb2 (4ydj B:108-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750527Domain d4ydjb2: 4ydj B:108-211 [273528]
    Other proteins in same PDB: d4ydja_, d4ydjb1, d4ydjh_, d4ydjl1
    automated match to d1mcww2
    complexed with bu3, cl, ipa, na, nag, peg

Details for d4ydjb2

PDB Entry: 4ydj (more details), 2.31 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody 44- vrc13.01 in complex with hiv-1 clade ae strain 93th057 gp120
PDB Compounds: (B:) light chain of antibody 44-vrc13.01

SCOPe Domain Sequences for d4ydjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ydjb2 b.1.1.2 (B:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvaptec

SCOPe Domain Coordinates for d4ydjb2:

Click to download the PDB-style file with coordinates for d4ydjb2.
(The format of our PDB-style files is described here.)

Timeline for d4ydjb2: