SCOPe 2.08: Domain d4ydjl2: 4ydj L:108-211

Lineage for d4ydjl2 (4ydj L:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4ydjl2: 4ydj L:108-211 [273526]
   Other proteins in same PDB: d4ydja_, d4ydjb1, d4ydjh_, d4ydjl1
   automated match to d1mcww2
   complexed with bu3, cl, ipa, na, nag, peg

Details for d4ydjl2

PDB Entry: 4ydj, 2.31 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody 44- vrc13.01 in complex with hiv-1 clade ae strain 93th057 gp120

PDB Compounds: (L:) light chain of antibody 44-vrc13.01

SCOPe Domain Sequences for d4ydjl2:

Sequence; same for both SEQRES and ATOM records:

>d4ydjl2 b.1.1.2 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvaptec

Timeline for d4ydjl2:

• d4ydjl2 first appeared in SCOPe 2.05
  
• d4ydjl2 appears in SCOPe 2.07