SCOPe 2.08: Domain d4y16d1: 4y16 D:2-112

Lineage for d4y16d1 (4y16 D:2-112)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (31 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
Domain d4y16d1: 4y16 D:2-112 [273519]
Other proteins in same PDB: d4y16a1, d4y16b_, d4y16c2
automated match to d3q5ya1
complexed with 48g, nag

Details for d4y16d1

PDB Entry: 4y16 (more details), 2.6 Å

PDB Description: crystal structure of the mcd1d/nc-agc/inktcr ternary complex

PDB Compounds: (D:) Chimeric TCR Vbeta8.2 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4y16d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y16d1 b.1.1.0 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d4y16d1:

Click to download the PDB-style file with coordinates for d4y16d1.
(The format of our PDB-style files is described here.)

Timeline for d4y16d1: