Lineage for d4y16c2 (4y16 C:115-203)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 2353416Domain d4y16c2: 4y16 C:115-203 [273517]
    Other proteins in same PDB: d4y16a1, d4y16a2, d4y16b_, d4y16c1, d4y16d1, d4y16d2
    automated match to d2pyfa2
    complexed with 48g, ful, nag

Details for d4y16c2

PDB Entry: 4y16 (more details), 2.6 Å

PDB Description: crystal structure of the mcd1d/nc-agc/inktcr ternary complex
PDB Compounds: (C:) Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4y16c2:

Sequence, based on SEQRES records: (download)

>d4y16c2 b.1.1.2 (C:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d4y16c2 b.1.1.2 (C:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4y16c2:

Click to download the PDB-style file with coordinates for d4y16c2.
(The format of our PDB-style files is described here.)

Timeline for d4y16c2: