SCOPe 2.08: Domain d4y16c1: 4y16 C:1-114

Lineage for d4y16c1 (4y16 C:1-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4y16c1: 4y16 C:1-114 [273516]
   Other proteins in same PDB: d4y16a1, d4y16b_, d4y16c2
   automated match to d2pyfa1
   complexed with 48g, nag

Details for d4y16c1

PDB Entry: 4y16, 2.6 Å

PDB Description: crystal structure of the mcd1d/nc-agc/inktcr ternary complex

PDB Compounds: (C:) Chimeric TCR Valpha14/Jalpha18 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4y16c1:

Sequence; same for both SEQRES and ATOM records:

>d4y16c1 b.1.1.0 (C:1-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d4y16c1:

• d4y16c1 first appeared in SCOPe 2.05
  
• d4y16c1 appears in SCOPe 2.07