Lineage for d4y16a1 (4y16 A:6-185)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897194Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 1897235Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)
  8. 1897255Domain d4y16a1: 4y16 A:6-185 [273514]
    Other proteins in same PDB: d4y16a2, d4y16b_, d4y16c1, d4y16c2, d4y16d1, d4y16d2
    automated match to d3hujc1
    complexed with 48g, ful, nag

Details for d4y16a1

PDB Entry: 4y16 (more details), 2.6 Å

PDB Description: crystal structure of the mcd1d/nc-agc/inktcr ternary complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4y16a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y16a1 d.19.1.1 (A:6-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d4y16a1:

Click to download the PDB-style file with coordinates for d4y16a1.
(The format of our PDB-style files is described here.)

Timeline for d4y16a1: