Lineage for d4xuoa_ (4xuo A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777799Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1777800Protein automated matches [190770] (31 species)
    not a true protein
  7. 1778033Species Paenibacillus barcinonensis [TaxId:198119] [273505] (2 PDB entries)
  8. 1778034Domain d4xuoa_: 4xuo A: [273509]
    automated match to d1dyoa_
    complexed with ca

Details for d4xuoa_

PDB Entry: 4xuo (more details), 1.7 Å

PDB Description: structure of the cbm22-1 xylan-binding domain from paenibacillus barcinonensis xyn10c
PDB Compounds: (A:) Endo-1,4-beta-xylanase C

SCOPe Domain Sequences for d4xuoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xuoa_ b.18.1.0 (A:) automated matches {Paenibacillus barcinonensis [TaxId: 198119]}
aakagdillshsfeegttqgwtarggvkvdvtaeqayqgkqslqttgrteawngpslslt
dvvhknevveisgyvklvagsapadlkftverrdgngdtqydqvnaaeqvtdqkwvklqg
qysyeqgsslllylestdakaaylldefqirlvkaa

SCOPe Domain Coordinates for d4xuoa_:

Click to download the PDB-style file with coordinates for d4xuoa_.
(The format of our PDB-style files is described here.)

Timeline for d4xuoa_: