Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (31 species) not a true protein |
Species Paenibacillus barcinonensis [TaxId:198119] [273505] (2 PDB entries) |
Domain d4xuoa_: 4xuo A: [273509] automated match to d1dyoa_ complexed with ca |
PDB Entry: 4xuo (more details), 1.7 Å
SCOPe Domain Sequences for d4xuoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xuoa_ b.18.1.0 (A:) automated matches {Paenibacillus barcinonensis [TaxId: 198119]} aakagdillshsfeegttqgwtarggvkvdvtaeqayqgkqslqttgrteawngpslslt dvvhknevveisgyvklvagsapadlkftverrdgngdtqydqvnaaeqvtdqkwvklqg qysyeqgsslllylestdakaaylldefqirlvkaa
Timeline for d4xuoa_: