![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Paenibacillus barcinonensis [TaxId:198119] [273505] (2 PDB entries) |
![]() | Domain d4xupe_: 4xup E: [273507] automated match to d1dyoa_ complexed with ca, gol |
PDB Entry: 4xup (more details), 2.43 Å
SCOPe Domain Sequences for d4xupe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xupe_ b.18.1.0 (E:) automated matches {Paenibacillus barcinonensis [TaxId: 198119]} aakagdillshsfeegttqgwtarggvkvdvtaeqayqgkqslqttgrteawngpslslt dvvhknevveisgyvklvagsapadlkftverrdgngdtqydqvnaaeqvtdqkwvklqg qysyeqgsslllylestdakaaylldefqirlvkaapen
Timeline for d4xupe_: