SCOPe 2.08: Domain d4xupe_: 4xup E:

Lineage for d4xupe_ (4xup E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Paenibacillus barcinonensis [TaxId:198119] [273505] (2 PDB entries)

8. Domain d4xupe_: 4xup E: [273507]
   automated match to d1dyoa_
   complexed with ca, gol

Details for d4xupe_

PDB Entry: 4xup, 2.43 Å

PDB Description: structure of the n-terminal cbm22-1-cbm22-2 tandem domain from paenibacillus barcinonensis xyn10c

PDB Compounds: (E:) Endo-1,4-beta-xylanase C

SCOPe Domain Sequences for d4xupe_:

Sequence; same for both SEQRES and ATOM records:

>d4xupe_ b.18.1.0 (E:) automated matches {Paenibacillus barcinonensis [TaxId: 198119]}
aakagdillshsfeegttqgwtarggvkvdvtaeqayqgkqslqttgrteawngpslslt
dvvhknevveisgyvklvagsapadlkftverrdgngdtqydqvnaaeqvtdqkwvklqg
qysyeqgsslllylestdakaaylldefqirlvkaapen

Timeline for d4xupe_:

• d4xupe_ first appeared in SCOPe 2.05
  
• d4xupe_ appears in SCOPe 2.07