Lineage for d1ptsa_ (1pts A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806367Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 806368Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 806369Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 806398Protein Streptavidin [50878] (1 species)
  7. 806399Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)
  8. 806585Domain d1ptsa_: 1pts A: [27350]

Details for d1ptsa_

PDB Entry: 1pts (more details), 2 Å

PDB Description: crystal structure and ligand binding studies of a screened peptide complexed with streptavidin
PDB Compounds: (A:) streptavidin

SCOP Domain Sequences for d1ptsa_:

Sequence, based on SEQRES records: (download)

>d1ptsa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Sequence, based on observed residues (ATOM records): (download)

>d1ptsa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapagsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOP Domain Coordinates for d1ptsa_:

Click to download the PDB-style file with coordinates for d1ptsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ptsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ptsb_