SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4xk9f1 (4xk9 F:1-208)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2074176Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2074177Protein automated matches [193506] (6 species)
    not a true protein
  7. 2074178Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)
  8. 2074424Domain d4xk9f1: 4xk9 F:1-208 [273496]
    Other proteins in same PDB: d4xk9a2, d4xk9b2, d4xk9c2, d4xk9e2, d4xk9f2, d4xk9h2, d4xk9i2, d4xk9j2
    automated match to d3sioc_
    complexed with 41j, cl

Details for d4xk9f1

PDB Entry: 4xk9 (more details), 2.2 Å

PDB Description: crystal structure of a-achbp in complex with pinnatoxin g
PDB Compounds: (F:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d4xk9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk9f1 b.96.1.0 (F:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d4xk9f1:

Click to download the PDB-style file with coordinates for d4xk9f1.
(The format of our PDB-style files is described here.)

Timeline for d4xk9f1:

  • d4xk9f1 first appeared in SCOPe 2.05, called d4xk9f_