Lineage for d4x98b1 (4x98 B:238-341)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766268Domain d4x98b1: 4x98 B:238-341 [273493]
    Other proteins in same PDB: d4x98a1, d4x98a2
    automated match to d4byha1
    complexed with bma, fuc, man, nag

Details for d4x98b1

PDB Entry: 4x98 (more details), 2.5 Å

PDB Description: immunoglobulin fc heterodimer variant
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4x98b1:

Sequence, based on SEQRES records: (download)

>d4x98b1 b.1.1.0 (B:238-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Sequence, based on observed residues (ATOM records): (download)

>d4x98b1 b.1.1.0 (B:238-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
rvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d4x98b1:

Click to download the PDB-style file with coordinates for d4x98b1.
(The format of our PDB-style files is described here.)

Timeline for d4x98b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4x98b2