Lineage for d4x98a1 (4x98 A:237-339)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748502Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 2748503Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2748546Domain d4x98a1: 4x98 A:237-339 [273486]
    Other proteins in same PDB: d4x98a2, d4x98b1, d4x98b2
    automated match to d1hzhh3

Details for d4x98a1

PDB Entry: 4x98 (more details), 2.5 Å

PDB Description: immunoglobulin fc heterodimer variant
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4x98a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x98a1 b.1.1.2 (A:237-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d4x98a1:

Click to download the PDB-style file with coordinates for d4x98a1.
(The format of our PDB-style files is described here.)

Timeline for d4x98a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4x98a2