SCOPe 2.08: Domain d4x98a1: 4x98 A:237-339

Lineage for d4x98a1 (4x98 A:237-339)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d4x98a1: 4x98 A:237-339 [273486]
   Other proteins in same PDB: d4x98a2, d4x98b1, d4x98b2
   automated match to d1hzhh3

Details for d4x98a1

PDB Entry: 4x98, 2.5 Å

PDB Description: immunoglobulin fc heterodimer variant

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4x98a1:

Sequence; same for both SEQRES and ATOM records:

>d4x98a1 b.1.1.2 (A:237-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d4x98a1:

• d4x98a1 first appeared in SCOPe 2.05
  
• d4x98a1 appears in SCOPe 2.07