SCOPe 2.08: Domain d4xk9b1: 4xk9 B:1-208

Lineage for d4xk9b1 (4xk9 B:1-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d4xk9b1: 4xk9 B:1-208 [273479]
   Other proteins in same PDB: d4xk9a2, d4xk9b2, d4xk9c2, d4xk9e2, d4xk9f2, d4xk9h2, d4xk9i2, d4xk9j2
   automated match to d3sioc_
   complexed with 41j, cl

Details for d4xk9b1

PDB Entry: 4xk9, 2.2 Å

PDB Description: crystal structure of a-achbp in complex with pinnatoxin g

PDB Compounds: (B:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d4xk9b1:

Sequence; same for both SEQRES and ATOM records:

>d4xk9b1 b.96.1.0 (B:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Timeline for d4xk9b1:

• d4xk9b1 first appeared in SCOPe 2.05, called d4xk9b_
  
• d4xk9b1 appears in SCOPe 2.07