SCOPe 2.08: Domain d4xhei1: 4xhe I:1-207

Lineage for d4xhei1 (4xhe I:1-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d4xhei1: 4xhe I:1-207 [273478]
   Other proteins in same PDB: d4xhea2, d4xheb2, d4xhec2, d4xhed2, d4xhee2, d4xhef2, d4xheg2, d4xheh2, d4xhei2, d4xhej2
   automated match to d2wnje_
   complexed with 40p, ca, cl

Details for d4xhei1

PDB Entry: 4xhe, 1.9 Å

PDB Description: crystal structure of a-achbp in complex with pinnatoxin a

PDB Compounds: (I:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d4xhei1:

Sequence, based on SEQRES records:

>d4xhei1 b.96.1.0 (I:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records):

>d4xhei1 b.96.1.0 (I:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwklns
lmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrls
fmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtrq
vqhysccpepyidvnlvvkfrer

Timeline for d4xhei1:

• d4xhei1 first appeared in SCOPe 2.05, called d4xhei_
  
• d4xhei1 appears in SCOPe 2.07