Lineage for d3x1wa_ (3x1w A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125702Species Norway rat (Rattus norvegicus) [TaxId:10116] [194536] (6 PDB entries)
  8. 2125705Domain d3x1wa_: 3x1w A: [273468]
    automated match to d4dxaa_
    complexed with cd, gdp, mg

Details for d3x1wa_

PDB Entry: 3x1w (more details), 1.2 Å

PDB Description: ras-related protein rap1b with gdp
PDB Compounds: (A:) Ras-related protein Rap-1b

SCOPe Domain Sequences for d3x1wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x1wa_ c.37.1.8 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwsncaflessakskinvneifydlvrqinr

SCOPe Domain Coordinates for d3x1wa_:

Click to download the PDB-style file with coordinates for d3x1wa_.
(The format of our PDB-style files is described here.)

Timeline for d3x1wa_: