SCOPe 2.07: Domain d3x1zb_: 3x1z B:

Lineage for d3x1zb_ (3x1z B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [194536] (6 PDB entries)

8. Domain d3x1zb_: 3x1z B: [273465]
   automated match to d4dxaa_
   complexed with gnp, gol, mg

Details for d3x1zb_

PDB Entry: 3x1z, 1.25 Å

PDB Description: ras-related protein rap1b(t65a) with gppnhp

PDB Compounds: (B:) Ras-related protein Rap-1b

SCOPe Domain Sequences for d3x1zb_:

Sequence; same for both SEQRES and ATOM records:

>d3x1zb_ c.37.1.8 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqfaamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwsncaflessakskinvneifydlvrqinr

Timeline for d3x1zb_:

• d3x1zb_ first appeared in SCOPe 2.05
  
• d3x1zb_ appears in SCOPe 2.06
  
• d3x1zb_ appears in the current release, SCOPe 2.08