Lineage for d4utsd_ (4uts D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940765Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)
  8. 2940859Domain d4utsd_: 4uts D: [273459]
    automated match to d2iova_
    mutant

Details for d4utsd_

PDB Entry: 4uts (more details), 2.03 Å

PDB Description: room temperature crystal structure of the fast switching m159t mutant of fluorescent protein dronpa
PDB Compounds: (D:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d4utsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4utsd_ d.22.1.0 (D:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvntalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs

SCOPe Domain Coordinates for d4utsd_:

Click to download the PDB-style file with coordinates for d4utsd_.
(The format of our PDB-style files is described here.)

Timeline for d4utsd_: