SCOPe 2.08: Domain d4s11a1: 4s11 A:6-130

Lineage for d4s11a1 (4s11 A:6-130)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4s11a1: 4s11 A:6-130 [273449]
   Other proteins in same PDB: d4s11a2
   automated match to d4cdgc_
   mutant

Details for d4s11a1

PDB Entry: 4s11, 2 Å

PDB Description: gelsolin nanobody shielding mutant plasma gelsolin from furin proteolysis

PDB Compounds: (A:) gelsolin nanobody

SCOPe Domain Sequences for d4s11a1:

Sequence; same for both SEQRES and ATOM records:

>d4s11a1 b.1.1.1 (A:6-130) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtryadsak
grftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqgtqvtv
sshhh

Timeline for d4s11a1:

• d4s11a1 first appeared in SCOPe 2.05, called d4s11a_
  
• d4s11a1 appears in SCOPe 2.07