Lineage for d4s11a1 (4s11 A:6-130)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (145 PDB entries)
  8. 2347773Domain d4s11a1: 4s11 A:6-130 [273449]
    Other proteins in same PDB: d4s11a2
    automated match to d4cdgc_
    mutant

Details for d4s11a1

PDB Entry: 4s11 (more details), 2 Å

PDB Description: gelsolin nanobody shielding mutant plasma gelsolin from furin proteolysis
PDB Compounds: (A:) gelsolin nanobody

SCOPe Domain Sequences for d4s11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s11a1 b.1.1.1 (A:6-130) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtryadsak
grftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqgtqvtv
sshhh

SCOPe Domain Coordinates for d4s11a1:

Click to download the PDB-style file with coordinates for d4s11a1.
(The format of our PDB-style files is described here.)

Timeline for d4s11a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4s11a2