SCOPe 2.06: Domain d2n1tb_: 2n1t B:

Lineage for d2n1tb_ (2n1t B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein automated matches [254664] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (4 PDB entries)

8. Domain d2n1tb_: 2n1t B: [273432]
   Other proteins in same PDB: d2n1ta_, d2n1tc_, d2n1td_, d2n1te1, d2n1te2
   automated match to d1sfcj_

Details for d2n1tb_

PDB Entry: 2n1t

PDB Description: dynamic binding mode of a synaptotagmin-1-snare complex in solution

PDB Compounds: (B:) syntaxin-1a

SCOPe Domain Sequences for d2n1tb_:

Sequence; same for both SEQRES and ATOM records:

>d2n1tb_ h.1.15.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
skqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyvera
vsdtkkavkyqs

Timeline for d2n1tb_:

• d2n1tb_ first appeared in SCOPe 2.05
  
• d2n1tb_ appears in SCOPe 2.07
  
• d2n1tb_ appears in the current release, SCOPe 2.08