Lineage for d5bnza2 (5bnz A:341-555)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802937Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2802938Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2803022Family b.53.1.0: automated matches [270315] (1 protein)
    not a true family
  6. 2803023Protein automated matches [270316] (3 species)
    not a true protein
  7. 2803024Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273426] (1 PDB entry)
  8. 2803025Domain d5bnza2: 5bnz A:341-555 [273429]
    Other proteins in same PDB: d5bnza1, d5bnzb1
    automated match to d4jxxa2
    complexed with cl, so4

Details for d5bnza2

PDB Entry: 5bnz (more details), 1.9 Å

PDB Description: crystal structure of glutamine-trna ligase /glutaminyl-trna synthetase (glnrs) from pseudomonas aeruginosa
PDB Compounds: (A:) Glutamine--tRNA ligase

SCOPe Domain Sequences for d5bnza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnza2 b.53.1.0 (A:341-555) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
apramcvlkplkvvitnypegqvenlelprhpkedmgvrvlpfgrelfidagdfeevppa
gykrlipggevrlrgsyviradeaikdadgnivelrcsydpdtlgknpegrkvkgvihwv
paegsvecevrlydrlfrsanpekaeeggsfldninadslqvlagcraepslgqanpedr
fqferegyfvadlkdsrpgkpvfnrtvtlrdswgq

SCOPe Domain Coordinates for d5bnza2:

Click to download the PDB-style file with coordinates for d5bnza2.
(The format of our PDB-style files is described here.)

Timeline for d5bnza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5bnza1