Lineage for d5bnza1 (5bnz A:8-340)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841999Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1842000Protein automated matches [190459] (41 species)
    not a true protein
  7. 1842146Species Pseudomonas aeruginosa [TaxId:208964] [273424] (1 PDB entry)
  8. 1842147Domain d5bnza1: 5bnz A:8-340 [273428]
    Other proteins in same PDB: d5bnza2, d5bnzb2
    automated match to d4jxxa1
    complexed with cl, so4

Details for d5bnza1

PDB Entry: 5bnz (more details), 1.9 Å

PDB Description: crystal structure of glutamine-trna ligase /glutaminyl-trna synthetase (glnrs) from pseudomonas aeruginosa
PDB Compounds: (A:) Glutamine--tRNA ligase

SCOPe Domain Sequences for d5bnza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnza1 c.26.1.0 (A:8-340) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
aapnflrqivqadldagkhakivtrfppepngylhighaksiclnfglaqefagdchlrf
ddtnpakedqeyidaieadikwlgfqwsgevcyasnyfdqlhawavelikagkafvcdlg
peemreyrgtltepgrnspyrdrsveenldlfarmkagefpdgarslrakidmgspnmnl
rdpilyrirhahhhqtgdkwciypsydfthgqsdaiegithsictlefedhrplyewfla
nlpvpaqprqyefsrlnlnytvtskrklkqlvdeghvsgwddprmstlsgyrrrgytpes
irnfcemigvnrasgvvdigmlefsirdhldat

SCOPe Domain Coordinates for d5bnza1:

Click to download the PDB-style file with coordinates for d5bnza1.
(The format of our PDB-style files is described here.)

Timeline for d5bnza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5bnza2