SCOPe 2.07: Domain d5bnzb2: 5bnz B:341-555

Lineage for d5bnzb2 (5bnz B:341-555)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
   barrel, closed; n=6, S=10; complex topology

4. Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families)

5. Family b.53.1.0: automated matches [270315] (1 protein)
   not a true family

6. Protein automated matches [270316] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273426] (1 PDB entry)

8. Domain d5bnzb2: 5bnz B:341-555 [273427]
   Other proteins in same PDB: d5bnza1, d5bnzb1
   automated match to d4jxxa2
   complexed with cl, so4

Details for d5bnzb2

PDB Entry: 5bnz, 1.9 Å

PDB Description: crystal structure of glutamine-trna ligase /glutaminyl-trna synthetase (glnrs) from pseudomonas aeruginosa

PDB Compounds: (B:) Glutamine--tRNA ligase

SCOPe Domain Sequences for d5bnzb2:

Sequence; same for both SEQRES and ATOM records:

>d5bnzb2 b.53.1.0 (B:341-555) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
apramcvlkplkvvitnypegqvenlelprhpkedmgvrvlpfgrelfidagdfeevppa
gykrlipggevrlrgsyviradeaikdadgnivelrcsydpdtlgknpegrkvkgvihwv
paegsvecevrlydrlfrsanpekaeeggsfldninadslqvlagcraepslgqanpedr
fqferegyfvadlkdsrpgkpvfnrtvtlrdswgq

Timeline for d5bnzb2:

• d5bnzb2 first appeared in SCOPe 2.05
  
• d5bnzb2 appears in SCOPe 2.06
  
• d5bnzb2 appears in the current release, SCOPe 2.08