![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
![]() | Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) ![]() |
![]() | Family b.53.1.0: automated matches [270315] (1 protein) not a true family |
![]() | Protein automated matches [270316] (2 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273426] (1 PDB entry) |
![]() | Domain d5bnzb2: 5bnz B:341-555 [273427] Other proteins in same PDB: d5bnza1, d5bnzb1 automated match to d4jxxa2 complexed with cl, so4 |
PDB Entry: 5bnz (more details), 1.9 Å
SCOPe Domain Sequences for d5bnzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bnzb2 b.53.1.0 (B:341-555) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} apramcvlkplkvvitnypegqvenlelprhpkedmgvrvlpfgrelfidagdfeevppa gykrlipggevrlrgsyviradeaikdadgnivelrcsydpdtlgknpegrkvkgvihwv paegsvecevrlydrlfrsanpekaeeggsfldninadslqvlagcraepslgqanpedr fqferegyfvadlkdsrpgkpvfnrtvtlrdswgq
Timeline for d5bnzb2: