Lineage for d5bnzb1 (5bnz B:8-340)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119569Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2119570Protein automated matches [190459] (50 species)
    not a true protein
  7. 2119813Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273424] (1 PDB entry)
  8. 2119815Domain d5bnzb1: 5bnz B:8-340 [273425]
    Other proteins in same PDB: d5bnza2, d5bnzb2
    automated match to d4jxxa1
    complexed with cl, so4

Details for d5bnzb1

PDB Entry: 5bnz (more details), 1.9 Å

PDB Description: crystal structure of glutamine-trna ligase /glutaminyl-trna synthetase (glnrs) from pseudomonas aeruginosa
PDB Compounds: (B:) Glutamine--tRNA ligase

SCOPe Domain Sequences for d5bnzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnzb1 c.26.1.0 (B:8-340) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
aapnflrqivqadldagkhakivtrfppepngylhighaksiclnfglaqefagdchlrf
ddtnpakedqeyidaieadikwlgfqwsgevcyasnyfdqlhawavelikagkafvcdlg
peemreyrgtltepgrnspyrdrsveenldlfarmkagefpdgarslrakidmgspnmnl
rdpilyrirhahhhqtgdkwciypsydfthgqsdaiegithsictlefedhrplyewfla
nlpvpaqprqyefsrlnlnytvtskrklkqlvdeghvsgwddprmstlsgyrrrgytpes
irnfcemigvnrasgvvdigmlefsirdhldat

SCOPe Domain Coordinates for d5bnzb1:

Click to download the PDB-style file with coordinates for d5bnzb1.
(The format of our PDB-style files is described here.)

Timeline for d5bnzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5bnzb2