| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein automated matches [226848] (11 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) |
| Domain d5aivb2: 5aiv B:76-199 [273420] Other proteins in same PDB: d5aiva1, d5aivb1, d5aivc1, d5aivd1 automated match to d2cvda1 complexed with gsh, m1w, mg |
PDB Entry: 5aiv (more details), 2.04 Å
SCOPe Domain Sequences for d5aivb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aivb2 a.45.1.1 (B:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl
Timeline for d5aivb2: