SCOPe 2.05: Domain d5aivb2: 5aiv B:76-199

Lineage for d5aivb2 (5aiv B:76-199)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)

8. Domain d5aivb2: 5aiv B:76-199 [273420]
   Other proteins in same PDB: d5aiva1, d5aivb1, d5aivc1, d5aivd1
   automated match to d2cvda1
   complexed with gsh, m1w, mg

Details for d5aivb2

PDB Entry: 5aiv, 2.04 Å

PDB Description: complex of human hematopoietic prostagandin d2 synthase (hh- pgds) in complex with an active site inhibitor.

PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5aivb2:

Sequence; same for both SEQRES and ATOM records:

>d5aivb2 a.45.1.1 (B:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d5aivb2:

• d5aivb2 is new in SCOPe 2.05-stable
  
• d5aivb2 appears in SCOPe 2.06
  
• d5aivb2 appears in the current release, SCOPe 2.08