Lineage for d5aivb1 (5aiv B:2-75)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854913Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries)
  8. 1855119Domain d5aivb1: 5aiv B:2-75 [273418]
    Other proteins in same PDB: d5aiva2, d5aivb2, d5aivc2, d5aivd2
    automated match to d2cvda2
    complexed with gsh, m1w, mg

Details for d5aivb1

PDB Entry: 5aiv (more details), 2.04 Å

PDB Description: complex of human hematopoietic prostagandin d2 synthase (hh- pgds) in complex with an active site inhibitor.
PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5aivb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aivb1 c.47.1.0 (B:2-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltent

SCOPe Domain Coordinates for d5aivb1:

Click to download the PDB-style file with coordinates for d5aivb1.
(The format of our PDB-style files is described here.)

Timeline for d5aivb1: