Lineage for d5aiva2 (5aiv A:76-199)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1736229Protein automated matches [226848] (11 species)
    not a true protein
  7. 1736246Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 1736350Domain d5aiva2: 5aiv A:76-199 [273417]
    Other proteins in same PDB: d5aiva1, d5aivb1, d5aivc1, d5aivd1
    automated match to d2cvda1
    complexed with gsh, m1w, mg

Details for d5aiva2

PDB Entry: 5aiv (more details), 2.04 Å

PDB Description: complex of human hematopoietic prostagandin d2 synthase (hh- pgds) in complex with an active site inhibitor.
PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5aiva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aiva2 a.45.1.1 (A:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d5aiva2:

Click to download the PDB-style file with coordinates for d5aiva2.
(The format of our PDB-style files is described here.)

Timeline for d5aiva2: