Lineage for d5aisd2 (5ais D:76-199)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326706Protein automated matches [226848] (13 species)
    not a true protein
  7. 2326726Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 2326806Domain d5aisd2: 5ais D:76-199 [273416]
    Other proteins in same PDB: d5aisa1, d5aisb1, d5aisc1, d5aisd1
    automated match to d2cvda1
    complexed with cwc, gsh, mg

Details for d5aisd2

PDB Entry: 5ais (more details), 1.85 Å

PDB Description: complex of human hematopoietic prostagandin d2 synthase (hh- pgds) in complex with an active site inhibitor.
PDB Compounds: (D:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5aisd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aisd2 a.45.1.1 (D:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d5aisd2:

Click to download the PDB-style file with coordinates for d5aisd2.
(The format of our PDB-style files is described here.)

Timeline for d5aisd2: