SCOPe 2.05: Domain d5aisa2: 5ais A:76-199

Lineage for d5aisa2 (5ais A:76-199)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)

8. Domain d5aisa2: 5ais A:76-199 [273412]
   Other proteins in same PDB: d5aisa1, d5aisb1, d5aisc1, d5aisd1
   automated match to d2cvda1
   complexed with cwc, gsh, mg

Details for d5aisa2

PDB Entry: 5ais, 1.85 Å

PDB Description: complex of human hematopoietic prostagandin d2 synthase (hh- pgds) in complex with an active site inhibitor.

PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5aisa2:

Sequence; same for both SEQRES and ATOM records:

>d5aisa2 a.45.1.1 (A:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d5aisa2:

• d5aisa2 is new in SCOPe 2.05-stable
  
• d5aisa2 appears in SCOPe 2.06
  
• d5aisa2 appears in the current release, SCOPe 2.08