SCOPe 2.05: Domain d5aiva1: 5aiv A:2-75

Lineage for d5aiva1 (5aiv A:2-75)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries)

8. Domain d5aiva1: 5aiv A:2-75 [273411]
   Other proteins in same PDB: d5aiva2, d5aivb2, d5aivc2, d5aivd2
   automated match to d2cvda2
   complexed with gsh, m1w, mg

Details for d5aiva1

PDB Entry: 5aiv, 2.04 Å

PDB Description: complex of human hematopoietic prostagandin d2 synthase (hh- pgds) in complex with an active site inhibitor.

PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5aiva1:

Sequence; same for both SEQRES and ATOM records:

>d5aiva1 c.47.1.0 (A:2-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltent

Timeline for d5aiva1:

• d5aiva1 is new in SCOPe 2.05-stable
  
• d5aiva1 appears in SCOPe 2.06
  
• d5aiva1 appears in the current release, SCOPe 2.08