![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Advenella mimigardefordensis [TaxId:1247726] [273384] (2 PDB entries) |
![]() | Domain d5ahsd2: 5ahs D:233-392 [273395] Other proteins in same PDB: d5ahsa1, d5ahsb1, d5ahsc1, d5ahsd1, d5ahse1, d5ahsf1 automated match to d1jqia1 complexed with coa, fad, sin, so4 |
PDB Entry: 5ahs (more details), 2.3 Å
SCOPe Domain Sequences for d5ahsd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ahsd2 a.29.3.0 (D:233-392) automated matches {Advenella mimigardefordensis [TaxId: 1247726]} krgfaalmsaynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadm svqleaarlmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpm erhvrdarmftiaggtaqilrtqvaskildmklpqtrdgy
Timeline for d5ahsd2: