SCOPe 2.06: Domain d5ahsd1: 5ahs D:3-232

Lineage for d5ahsd1 (5ahs D:3-232)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (25 species)
   not a true protein

7. Species Advenella mimigardefordensis [TaxId:1247726] [273374] (2 PDB entries)

8. Domain d5ahsd1: 5ahs D:3-232 [273394]
   Other proteins in same PDB: d5ahsa2, d5ahsb2, d5ahsc2, d5ahsd2, d5ahse2, d5ahsf2
   automated match to d1jqia2
   complexed with coa, fad, sin, so4

Details for d5ahsd1

PDB Entry: 5ahs, 2.3 Å

PDB Description: 3-sulfinopropionyl-coenzyme a (3sp-coa) desulfinase from advenella mimgardefordensis dpn7t: holo crystal structure with the substrate analog succinyl-coa

PDB Compounds: (D:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5ahsd1:

Sequence; same for both SEQRES and ATOM records:

>d5ahsd1 e.6.1.0 (D:3-232) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
eltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggrg
lstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpaic
isepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgigaf
itvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdgl

Timeline for d5ahsd1:

• d5ahsd1 first appeared in SCOPe 2.05
  
• d5ahsd1 appears in SCOPe 2.07
  
• d5ahsd1 appears in the current release, SCOPe 2.08