| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
| Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
| Protein automated matches [226934] (29 species) not a true protein |
| Species Advenella mimigardefordensis [TaxId:1247726] [273374] (2 PDB entries) |
| Domain d5ahsd1: 5ahs D:3-232 [273394] Other proteins in same PDB: d5ahsa2, d5ahsb2, d5ahsc2, d5ahsd2, d5ahse2, d5ahsf2 automated match to d1jqia2 complexed with coa, fad, sin, so4 |
PDB Entry: 5ahs (more details), 2.3 Å
SCOPe Domain Sequences for d5ahsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ahsd1 e.6.1.0 (D:3-232) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
eltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggrg
lstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpaic
isepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgigaf
itvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdgl
Timeline for d5ahsd1: